Basic Information
Basic information for the protein SLC35A2_oof_MP_6 from SLC35A2

Protein Name SLC35A2_oof_MP_6
Protein Position chrX:48904726-48906513[-]
Protein Type Out-of-Frame
Protein Length 95
Protein Sequence
MRLSWCSMWTRSSSQCPLSSTPCRITSSMLPSLTYQLPLSSLPRGAAKAIASASASASGPCVHQQPPGQPPPPQLSSHRGDLITEPFLPKSVLVK
(click to check full sequence)
Gene Name SLC35A2
Gene ID ENSG00000102100
Cancer Gene No
Transcriptome ID ENST00000445167
Quantitative Proteome
Post-translational Modifications
Protein-Protein Association
Cancer : Top:
Drug Sensitivity
Clinical Relevance
Cancer :